Mami Mujhe Check Karne Naheen Aati Theen Sonaakshi

Mami Mujhe Check Karne Naheen Aati Theen Sonaakshi

Movies »

Srushti sonaakshi sinha ne is baat se saaf inkaar kiya hai ki unki maan poonam sinha ko film 'Lutera' mein ranaveer Singh aur unke beech ke intimet scene se koi pareshaani thi. Sonaakshi ne bataaya, 'Vah shooting ke dauraan ek-do baar set par jaroor I theen, par iska matlab Yeh naheen tha ki vah meri shooting par najar rakhane I theen. Vah mujhe pik karne I theen, kyonki shooting ke baad hamein kaheen jaana tha. ' sonaakshi ne in sabhi khabaron ko jhuthalaate hue kaha, 'Maan jaanti hain ki main kis tarah ka kaam kar rahi hoon. Isliye vah mere kaam mein dakhal naheen deteen aur na hi main kuchh aisa kaam karoongi jisse unhein sharminda hona pade. ' vikramaaditya motavaani ke daayarekshan mein bani film lutera mein sonaakshi ranaveer Singh ke saath hain aur Yeh film shukravaar ko release hui hai.


Chhuttiyon Par Jaana Chaahati Hain Sonam

Chhuttiyon Par Jaana Chaahati Hain Sonam

Movies »

barakha sonam Kapoor in dinon apni film raanjhana ke sakses ko injauya kar rahi hain. Saath hi vah apne biji schedule se kuchh samay nikaal kar aaraam karna chaahati hain. Isliye in dinon kuchh naheen kar rahi hain. Sonam ka kehna hai ki lagaataar kaam karte rahane se main kaafi thak gayi hoon. Iske alaava raanjhana ke promotion ke liye bhi mujhe kaafi bhaagadaud karni padi hai. Ab choonki film hit ho gayi hai, isliye main teen maheene aaraam karoongi. Kya sonam kisi se rileshanaship mein hai? Sonam ka kehna tha: Abhi main akeli hoon aur bahut khush hoon. Kisi rishte mein naheen aana chaahati. Main apne aap ko jald hi kisi rishte me naheen dekhna chaahoongi. Kam teen maheene ki chhutti, aur main koshish karoongi ki mujhe koi pareshaan na kare.


Shahid Fir Kareinge Aaifa Award Host

Shahid Fir Kareinge Aaifa Award Host

Movies »

aaifa award sho ko 2012 mein host karne vaale Shahid Kapoor ko is saal bhi host karne ke liye chun liya gaya hai. 2012 ke aaifa award ko kaafi sakses mili thi, jis vajah se orgenaaijar Shahid ke kaam se kaafi khush hain. Vaise to, Shahid Kapoor apni film rainbo Rajkumar mein biji hain, iske baavajood aaifa award mein kaam kar rahe hai, jiske liye vah unhein apna biji schedule mainej karna pad raha hai. Pichhli baar ki tarah is baar bhi aaifa award makaaoo mein hi aayojit kiye jaaenge. Shahid ne kaha ki vah pichhli baar host karne par mili logon ke positive feedabaik se kaafi khush hain. Pichhli baar farahaan ke saath unhonne kaafi achha host kiya tha aur is baar vah chaahate hai ki unhein Shahrukh ke saath host karne ka mauka mile.


Chitrangadha Ne Bataaya Sefti Aip Ke Baare Mein

Chitrangadha Ne Bataaya Sefti Aip Ke Baare Mein

Movies »

Medha Chawla badhte aparaadhon ko dekhte hue mahilaaon ki sefti vaakai ek bada mudda ban gayi hai aur isse nipatne ke liye kai tarah ki koshishein ki ja rahi hain. Aveyaranes ke alaava teknaulaji ki bhi madad li ja rahi hai. Aise mein haal hi mein ek aip launch kiya gaya hai, jiska naam hai- vid you. Filhaal Yeh aif endrauyad phone par hi daaunalod kiya ja sakta hai. Is aip mein 'Painik batan' ki suvidha hai. Agar aap kisi museebat mein fansati hain, to is batan ko dabaakar aap un chaar logon tak apni lokeshan aur museebat mein hone ka sandesh pahuncha sakti hain, jinka number aapne is aip mein joda hoga. Desh mein apni tarah ka Yeh pehla prayaas hai, jise channel vi apne sho 'Gumaraah' ke teesare season ke saath lekar aaya hai. Iske baare mein channel ke general manager aur head prem kaamat ne bataaya, 'Sho par kaam karte hue hamein laga ki aise aip aaj ki jenareshan ke liye zaroori hai. Ismein chaar nanbars aid kiye ja sakte hain. Channel ke is inishiyetiv se aiktres Chitrangadha Singh bhi judi hain. Vah aur sho ke host karan kundra, donon is mauke par maujood the.


Saath Dikheinge Katareena-Hritik

Saath Dikheinge Katareena-Hritik

Movies »

Hritik roshan aur katareena kaif ki kemistri 'Jindagi na milegi dobaara' mein vaakai jbardast thi. Agar aapko lagta hai ki isse behtar kuchh naheen ho sakta, to inki aane waali agali film 'Baing baing' ka intajaar karein. Big baing is jodi ko bollywood ki hautest jodi bana sakti hai. Is baat ki sambhaavana bhi jyaada hai ki is film ko dekhne ke baad koi bhi cinema hall se niraash naheen niklega. Iske alaava, haai voltej stunt, behatareen intaranaishanal lokeshans aur vishaal-shekhar ka jhumaane vaala sangeet bhi is film ke dilchasp pahaloo hain. Is jodi ko kai filmamekars doharaane ke liye taiyaar the aur inko saath mein kaast karne ka intajaar kar rahe the, lekin sakses haath lagi 'Baing baing' ke nirmaataaon ke haath. Aakhir unke paas badhiya script jo taiyaar thi. Baharahaal, isi ke saath director siddhaarth aanand ab is film ko behatareen aur hairaan kar dene waali aikshan film banaane mein jute hain. Film ke do schedule poore ho chuke hain aur agala isi maheene mein Europe mein shuroo hoga. Pehle schedule ke dauraan Thailand mein film ki unit ko kaafi pareshaaniyon ka saamana karna pada. Baavajood iske, Hritik-kait ki jodi ne vahaan kai khatarnaak aikshan scene shoot kiye. Vahaan se ve grees gaye. Film ke is doosare schedule mein romantic sequence filmaae gaye. Ab baaki film ki shooting faar East, Europe aur India mein poori hogi. 'Baing baing' ko fauks star studio bana raha hai aur iski release det 1 May, 2014 rakhi gayi hai.


Smaul Faimili Drama Naheen Banaana Tha Vikramaaditya

Smaul Faimili Drama Naheen Banaana Tha Vikramaaditya

Movies »

Reena paareek . . 'Lutera' banaane ka aaidiya kaise aaya? Yeh kahaani mainne bahut pehle likhi thi, lekin mainne is par film banaane ki naheen sochi thi. Fir Yeh kahaani mere ek dost ne padhi. Ek din main ek party mein tha aur us dost ne mujhe yaad dilaaya ki tumhaari vah kahaani bahut achhi thi. To Yeh kahaani mujhe yaad I. Magar new yaurk mein likhi Yeh chaar pannon ki kahaani par kya ho sakta tha Yeh tay karna baaki tha. Tab main bhavaani heeraapanda ke paas gaya aur unase diskas kiya. Is tarah film bani. Yeh film 'Udaan' se kaafi alag hai aur lambe gaip ke baad I. Gaip to baai difaultahogaya. Yahafilm 2007 mein banaanaachaahataatha, lekinpahale 'Udaan' bani. Uske baad kuchh aurabanaanekeekoshishthi, lekinvahanaheenban pai auratabamainneluteraabanaaneechaahi. Isaprauses mein lamba samay lagagaya. Yahaekakamarshalaaurabadestaarsakeefilmahaikyonkijindageebharatoekasmaulafaimileedraamaanaheen bana sakataatha na main? Mujhebhi kuchh badaakarana tha. Filmake liye bajat bheeachhaathaaaurastaars bhi. Iski reesarch kitni chaileinjing thi? Kaafeechaileinjing rahi hai, kyonkireesarch mein hameinkaafeetaaimalaga. Usajamaane mein log kaisekapade, kaisegahanepahanatethe, unakegharon mein bijleehoteetheekinheen- harachhoteesechhoteecheejonparareesarchakeegai hai. Vaisemeri maan bangaali hain tohar samar vekeshan mein main vahaanjaata raha hoon, isaliyevahaankekalcharakebaare mein mujhekaafi kuchh pata hai. Kya donon stars turant is film ke liye taiyaar ho gaye? Naheen. Ranaveeranekaafeetaaimaliya. Vahashaukdatha, jab main yahaskriptalekarausake paas gaya. Usanekaafeesochaneke baad haan kaha magar sonaaksheeneturant haan kahadi thi. Kya aap bachapan se hi filmamekar banana chaahate the? Main toinjiniyrabananaachaahataatha, lekinyah shauk tojab 18-19 saal kaatha, tabasepaidaahuaa. Daraasal, main das saal kaatha, tabaheemeremaata-pitaakaadivaursaho gaya tha. Tabameri maan nelaainapradyoosaraka kaam jauinakiya. Ekateenaejarabesdateeveeshoke liye unhonnemujheaurameredostonkobheevahaan kaam ke liye bulaaya. Iske baad heemainnelikhnaashurookiya. Magar udaan ke baad aap turant laaimalaait mein aa gaye! Haan, magar isakepeechhe bees saal kaastraagal hai. Kaam achhaakarogeto log pahachaanaheeletehain. Magar aapakobahutamehanatakaraneepadti hai. Sanjayaleelaabhansaaleene 'Khaamoshi' banaaiauravahaflaup rahi, magar fir unhonnesalamaanake saath 'Ham dil dechuke sanam' banaai. Imtiyaajanebheesocha na thaabanaaiauraisake laup rahanekebaavajoodabadeefilm 'Jabavi met' banaai. Aapki film par sanjaya leela bhansaali ki chhaap dikhaai deti hai? Mainnechhah saal unke saath kaam kiya hai. Filmonkebaare mein jo kuchh seekhaahaiunaseheeseekha hai. Unasebahetarakraaft men koi naheenindastreemein. Isakealaavaaanuraagaki chhaap bheemereefilmon mein dikhaaideti hai. Kya aap doosaron ki kahaani ko daayarekt kareinge? Haan, jaroor. Magar isameinvakt hai. Main sabse yahi kehta hoon kiphaleedoya teen filmein khud heelikhoaurabanaao, kyonkiusake liye aap lad sakatehain. Agar kahaaneeaurakirdaaradoosarekehote hain toaapausake liye ladtenaheen. Jabaaapalikhneseubanelageintodoosaronkeekahaaneelokyonkiusameinaapakoekanayaapanalagega. Main koi kahaaneelikhta hoon, tosekandadraaftaanuraagalikhta hai. Isasekahaaneejyaadaabehatarabanapaati hai. Sau saal ke baad bhi hamaara cinema world leval par naheen pahuncha hai. Abapahunchanaashurooho gaya hai. Koi bheebadalavaaovaranaaitanaheenhota. Agar main 'Udaan' 2005 mein banaataato use dasathiyetarabheenaheenmilte, lekinababanaaito 200 thiyetaramile. Jab main yahafilmakaansafilmafestivlake liye lekar gaya tologonnesamajhaaki aisi filmeinbheeindiya mein banateehain. Vahaankelogonke liye inyinsinemaakedoheematalabahaiyaatobaulivudamasaalaafilmayaaaartafilmein. Midilof the laainabheefilmeinbanati hain India mein, isakeeunheinummeedanaheen thi. 'Udaan' ki tarah kaifilmein hain joab aati tounheinpahachaanamilti. Blaikafraaide samay sepahale aa gayi. Agar ab aati tousakeekamarshalavailyoobheekaafeehoti. Raakeshameharaaauradeepaakarabenarji jis tarah keefilmein bana rahe hain, unakoshaayadapahaleitaneeeksepteinsanaheenmilti. Ab samay ke saath darshakamachyorahogaehain. To ab bhi agar kami rahi hai to kahaan rahi hai? Daraasal, world mein umrakehisaabasesinemaadivaaidahai, jabakihmaareyahaanklaasakehisaabasefilmeinbanateehain. Yahaanchaahesingalaskreen-maltiplaiksakah lein, loaraklaas-midilklaasakah lein yaavaaitakaular-blookaularakah lein, inado tarah kelogonke liye alag-alag filmeinbanateehain. Lekinabafilmamekarsabheesamajhane lage hain kisinemaakedovarldahotehain. Maltiplaiks aane ke baad logonke paas chauisahaiauraveapaneemarjeekeefilm dekh sakatehain. Yahi vajah haikiachhe-achhesinemaakobadhaava mil raha hai.


Bheja Fraai Kar Diya TV Ke Latake-jhatke Ne

Bheja Fraai Kar Diya TV Ke Latake-jhatke Ne

Movies »

office ki teinshan, ghar ki udhedbun aur pata naheen kya-kya. . . Man to hua kuchh gappein-shappein hon lekin hon to kaise aur kiske saath? Haath mein remote tha, to dab gaya TV ka batan. Kuchh minute dekha, channel change kiya, to doosare sho mein bhi vahi, teesare, chauthe, paanchavein aur kanteenyoo dekha hota to sankhya dasvein-baaravein tak pahunch jaati, kuchh aisa dikha jo hajam naheen hua aur dimaag bhi jyaada lagaana pada. Bhaabho ka sho aaya, to gajab ka bhadak rahi theen sandhya bahoo par. Sandhya ne apne devar ki shaadi krischan ladki se karaai, bhaabho ko manaaya, parivaar ka bhala socha aur na jaane kya-kya. Jis krischan ladki se vah itna chidhti thi aaj vahi bahoo unki fevarit hai. Bhaabho Yeh bhi bhula rahi hain ki kis tarah sandhya ne apne pati sooraj ko fauren ke kauntest mein hissa dilvaakar use aage badhaane ke baare mein socha. Kyon bhaabho aap to khoob bolti theen ki main bhedabhaav naheen karti, to Yeh kya melabhaav hai? Ek cheej aur yaad I jo samajhna mushkil hai. 'Baalika vadhoo' ke jagiya mein pata naheen kya baat hai jo har ladki usi par marne lagti hain. Ab vaise, to adhiktar ladkiyaan van vuman main ko hi pasand karti hain lekin ye jagiya pata naheen kya tarakeeb bhidaata hai. Jahaan andar hi andar ganga use bahut pasand karti hai, vaheen ab usaki pehli patni ki nanad saanchi bhi jagiya ki deevaani ho gayi hai. Jabki in sabhi ko pata hai ki isse pehle jagiya ka saath kitni ladkiyon ke saath raha. Vaise, ladkiyon ko rijhaane ke tips to ladke jagiya se lein. Gopi aapki to aavaaj bhi naheen niklati saas ke saamane, ab itna jalwa dikhaaogi, to odiyans dar jaaegi Baba! Vaheen, sanskaar. . . Dharohar apanon ki mein, ultra modern bhoomi kaise itne puraane vichaaron vaale parivaar mein sir par palloo rakhakar ghoom rahi hai, hairaan karni waali baat hai. Shomekars agar use saadi ki bajaay doosare shoj ki bahuon ki tarah bina sar dhake soot mein dikha dete, to kuchh samajh mein bhi aata lekin vah to saadi, bindiya, jhumake mein latake-jhalake maar rahi hai! Had to punarvivaah- ek nai ummeed mein divya bhi kam naheen kar raheen. Apne hi ex lavar ko usaki patni se milvaane ke liye unke ghar tak pahunch gayi hain. Jabki vah aajatak apni patni ko chhod divya se hi pyaar karta hai. Ab samajhne waali baat Yeh hai ki aise mein vah apni patni ke kareeb aaega ya divya ke! Ab aap sochoge ki itna bheja kharaab hota hai, to TV dekhte hi kyon ho? Bhai, kar bhi kya sakte hain ghar mein hokar TV se to peechha chhudaaya naheen ja sakta. Aakhir TV ke in mirch- masaalon ka tadka hi aisa hai ki bina svaad liye maja kahaan aata hai.


July Ke 4 Shukravaaron Mein 21 Filmon Ki Baarish

July Ke 4 Shukravaaron Mein 21 Filmon Ki Baarish

Movies »

chandra mohan sharma August mein kai badi filmein aa rahi hain, to isse darakar July ke chaar hafton mein hi 21 filmein release ho rahi hain. Is tarah daanv par 350 karod hain. Ab dekhne waali baat Yeh hai ki is bheed mein se kaun-si film apni jagah bana paati hai : Agale maheene mein release ho rahi mega bajat aur maltistaarar filmon, chennai express, satyaagrah, van upon A time in Mumbai dobaara ke alaava John Abraham staarar 'Madras kaife' ka industry mein kaafi khauf hai. Yahi vajah hai ki July mein kai nae aur chhote filmamekars apni filmein release karne ka faisala kiya hai. Is tarah saavan ke maheene mein pehli baar box office par 21 filmon ke saath 350 karod rupaye ka daanv laga hai. Haalaanki trade panditon ki maanein, to in chaar hafton mein 20 se jyaada filmein release karna kisi ke liye bhi faayde ka sauda saabit naheen hoga. Hogi filmi baarish August ke maheene se lekar saal ke aakhir tak industry ke naami mekars aur top stars ki mega bajat filmon ki aandhi ke beech kam bajat aur nai star kaast ke saath bani filmein gum ho jaati hain. Yahi vajah hai ki is maheene sanjaya datt staarar 'Pulisgiri', sonaakshi aur ranaveer ki 'Lutera', farahaan Akhtar 'Bhaag milkha bhaag', shruti Hassan va Girish ki 'Ramaiya vastaavaiya', rishi Kapoor aur Irfan Khan staarar 'Di de' aur sani deol va kangana staarar 'I love enavaai' ke beech kareeb 15 aur filmein cinemagharon par dastak deingi. Ab Yeh baat aur hai ki inka trade aur darshakon ki badi class mein krej najar naheen aata. Ho sakta hai karishma film distribyooshan ke business se jude sureindr ke. Paul kehte hain, 'Beshak is maheene bade nirmaataaon aur sitaaron ki chaar paanch filmein aa rahi hain lekin jaroori naheen box office par sirf aisi filmein hi kaamayaab hon. Darshakon ki soch ab badli hai. Box aafis par total kalekshan mein 55 se 60 feesadi ka hissa maltiplekson se aata hai, jahaan yuva darshak nai filmon ka business tay karte hain. 50 karod ke bajat mein bani 'Himmatavaala' ko darshak nakaarate hain, to seemit bajat aur nai star kaast ke saath bani kaai po che, aashiki 2 , fukare jaisi aath-das karod mein bani filmein apni laagat se paanch se das guna ka business karti hain. ' yahi vajah hai ki paul is maheene release hone waali bajaate raho, ishk, bi. A. Paas, siksateen jaisi seemit bajat aur nai star kaast ke saath bani filmon ko bhi box office par karishma karne waali filmein maanate hain. 350 karod ka hai khel film nirmaata Krishna ke . Chaudhari ke mutaabik , ' box office ka mizaaz ab badal chuka hai. 200 karod ki jaadui kalekshan ko touch karti ' ye javaani hai deevaani ' ki kaamayaabi saabit karti hai ki yang daayarektars aur fresh team ke saath achhi film bane , to darshakon ki har class us film ko haathonhaath legi. ' vev samooh ke CEO Rajiv ke gupta kehte hain , ' darshakon ka test badana hai aur ise dekhte hue hi humne apne maltiplekson par agar lutera , bhaag milkha bhaag , di - de aur anuraag kashyap ki paanch daayarektaron ke saath bani ' shaarts ' ke saath bajaate raho , ishk , siksateen nasha jaisi of beet filmon ko bhi pehle se book kiya hai. Filhaal , is maheene release ho rahi lutera , pulisgiri , bhaag milkha bhaag , ramaiya vastaavaiya , di - de , shaurts , I love N vaai , aur banaaras ki prushthabhoomi par bani director maneesh tivaari ki ' ishk ' ka bajat hi 250 karod ke kareeb hai. Yaani baaki bachi filmon ka total bajat 100 karod ke aaspaas hai. Ab dekhte hain ki daanv par lage industry ke in 350 karod mein se kaun - si film kitni rakam vaapas lekar aat i hai.


Moovi Rivyoo Pulisgiri

Moovi Rivyoo Pulisgiri

Movies »

Chandra mohan sharma nai Delhi. . South ki masaala aikshan thriller filmon ka reemek banaana ab hindi film mekars ki majaboori banti ja rahi hai. Daraasal, kuchh saal pehle 'Gajani' aur 'Vaunted' ko box office par mili jabardast kaamayaabi ke baad 'Ready', 'Rowdy Rathore', 'Bodyguard', 'Singham' sahit kai filmein super hit saabit huin. Sequel aur reemek ke is season mein sanjaya datt ne bhi reemek ka sahaara liya hai. Nirmaata ti. Pi. Agrawal ne pichhle saal tamil box office par blockbuster rahi director ke. S. Ravi Kumar ki film 'Saami' ke raaits achhi price mein haasil karke ise hindi mein banaane ki kamaan bhi ravi Kumar ko hi saunpi. Film ki shuruaat se pehle sanjaya datt ke bachapan ki tasveeron se lekar unke career ke shuruaati daur se ab tak ki tasveerein dikhaakar shaayad praudakshan company sanjoo ke fains ki hamadardi ko bhi batorana chaahati hai. Vaheen, sanjaya datt ne Supreme court se mili mohlat ke dauraan sabse jyaada vakt isi film ko diya. Film mein aise kai aikshan scene hain, jo singal screen aur chhote seintaron par masaala filmon ke shaukeenon ki kasauti par jaroor khara utareinge. Kahaanee: Rudra (sanjaya datt) Hyderabad ke ek chhote se kasbe naagaapuram mein depyuti commissioner of police ke pad par tainaat hota hai. Rudra ke kaam karne ka tareeka bilkul alag hai. Aparaadhiyon se saamana hote hi rudra achaanak raudr roop mein aa jaata hai. Naagaapuram ek aisa chhota sa shahar hai, jahaan nagori (prakaash raaj) ka aatank hai. Kabhi sadak kinaare futapaath par baithakar bheekh maangane vaala nagori ab aisa Don ban chuka hai, jiske darbaar mein emaelae se lekar ministar aur aala afsar haajiri lagaane pahunchate hain. Nagori myoojik ka jabardast shaukeen hai. Vah apne darbaar mein har vakt dholak aur haaramoniym par apne haath aajamaata najar aata hai. Is chhote se shahar mein faile nagori ke aantak ka rudra safaaya karne mein lag jaata hai. Rudra ka mission nagori aur uske gundon ka safaaya karna hai. Usaki bahaaduri dekhkar sahar (praachi Desai) use chaahane lagti hai. Hindu maan aur muslim pita ki ikalauti sahar ko naheen maaloom ki maafiya ko khatm karne ka rudra ka tareeka khoonakharaabe se bhara hai. Aikting: Singham ke baad ek baar fir prakaash raaj ne apni damadaar acting se prabhaavit kiya hai. Prakaash aur sanjaya ka jab bhi aamana-saamana hua, har baar prakaash hi sanjaya par bhaari pade. 'Jila Ghaziabad' ke baad ek baar fir sanjaya aikshan karte najar aae, lekin is baar unke aikshan dekhkar aapko 'Vaunted', 'Rowdy Rathore' aur 'Singham' ke aikshan yaad aaenge. Vaheen, agar dialogue dilivri ki baat karein to sanjoo ismein Salman, Akshay aur Ajay ke mukaabale bahut door najar aate hain. Praachi Desai is film mein vahi sab kuchh kar rahi hain, jaisa aikshan film ki hiroin karti najar aati hain. Hero ke saath ek do gaanon mein thumake lagaana aur hero ke haath se gundon ki pitaai dekhkar khush hona. Raajapaal Yadav apaset karte hain. Vaheen, murali sharma aur mukesh tivaari ne kuchh naya karne ke bajaay theek vaisa kiya jaise isse pehle karte najar aae. Daayarekshan: Ke. S. Ravi Kumar ne script aur kirdaaron par pakad banaane se jyaada dhyaan sanjaya datt se Salman Khan jaise aikshan scene karaane mein lagaaya. Aise mein kahaani ki sust raftaar darshakon ke sabr ka imtihaan leti hai. Vaheen, aikshan filmon ke shaukeenon ko unhonne jamkar taaliyaan bajaane ka poora mauka bhi diya hai. Sangeet: Praachi aur sanjaya par filmaaya 'Chura ke le ja, bhaga ke le ja' aur prakaash raaj, sanjaya par filmaaya 'Jhoom baraabar jhoom' gaanon ka filmaankan achha ban pada hai. Kyon dekhein: Agar sanjaya ke fan hain aur apne hero ko ek baar fir dekhne ko betaab hain, to 'Pulisgiri' aapke liye hai, kyonki is film ke baad aapke chahete hero ki agali film aane mein lamba vakt lag sakta hai. Poori tarah aikshan se maalaamaal is 'Pulisgiri' mein kahaani dhoondhane ki koshish kareinge to apaset hi honge.


Tote Ki Tarah Rat Kar Egzaam Hall Mein Ulati Karne Ka Kya Matlab

Tote Ki Tarah Rat Kar Egzaam Hall Mein Ulati Karne Ka Kya Matlab

Movies »

prashaant jain Imran Khan hairaan hain deeyoo ki 100 parseint kat of ke baare mein sunakar. Pichhle dinon Delhi aae Imran Khan ne hamaare saath khaas baatcheet mein kaha ki mujhe lagta hai hamaara education system kharaab ho chuka hai. Ismein ham brilinyats ki bajaay rattoo tote taiyaar kar rahe hain. Khud Imran ne gurukul mein rahakar padhaai ki aur apni sakses ka kredit bhi vah use hi dete hain : Aajkal deeyoo mein edamishn ka daur chal raha hai. Kat of 100 parseint tak hoti hai, kya kaheinge is system par? Main to kabhi college gaya hi naheen. Lekin mujhe Yeh soch kar hairaani ho rahi hai ki agar kataof 100 parseint hai, to ve log usase jyaada kya kar sakte hain. Hamaare Indian education system ke baare mein meri rai yahi hai ki Yeh system behad buri tarah daimej ho gaya hai. Yeh system toot chuka hai. Apne yahaan ham logon ko tote banaane ki koshish karte hain ki ve jyaada se jyaada cheejon ko rat lein aur egjaam hall mein jaakar aansar sheet par usaki ulati kar dein. Jabki hakeekat mein unako na to kuchh samajh mein aaya aur aage na hi unhein kuchh yaad rahega. Main poochhana chaahanooga ki ham aakhir school jaate kyon hain? Ham school mein Yeh seekhane jaate hain ki cheejon ko kaise seekhana hai. Ab har koi to saaintist naheen banega. Isliye hamein Yeh seekhana hoga ki cheejon ko kaise seekhana hai. Agar main kuchh naya karna chaahata hanoo, to vah kaise kar sakta hanoo. Apni padhaai ke dauraan main science ke maamale mein kaafi kachcha tha. Fijiks, kemistri mujhe kabhi samajh naheen I. Na hi mujhe kabhi achhe maarks mile. Jabki mere bahut se aise dost the, jo ki taupars the. Unke number 80-90 parseint hua karte the. Lekin aaj main unase jyaada padhta hanoo aur cheejaane ko jyaada jaanta hanoo. Daraasal, unhonne ek partikular system ko follow kiya ki in cheejon ko yaad karna hai aur likhna hai. Lekin unhonne Yeh naheen socha ki iske baad ham iska kareinge kya. Aaj main jab kitaabein padhta hanoo, to mujhe pata hai ki mujhe unamein kya intarest hai. Hamaare system ke daimej ka andaaja isi baat se lagaaya ja sakta hai ki chhote-chhote bachche steras ki vajah se syoosaaid kar rahe hain. Main jaanana chaahata hanoo ki aakhir ham kar kya rahe hainoo skooling ke dauraan aap kaise student the? Mera skooling eksapeeriyans bahut kharaab raha. Mainne chhah-saat school badle. Mere pehle school mein aisa tha ki agar aapne padhaai naheen ki ya fir galat joote pahane hain, to aapki pitaai hoti thi. Mere saath bhi yahi sab hota tha. Mere saath kuchh praublams thi. Main apni aankhon ko ajeeb tareeke se ghumaata tha aur theek se bol naheen paata tha. Aise mein, mujhe us school se nikaala gaya. Uske baad bhi ek se doosare school ka silsila chalta raha aur mainne 10 saal ki umr tak chhah-saat school badle. Aakhirkaar das saal ki umr mein main ooti se kareeb dhaai - teen ghante ke raaste par sthit ek gurukul mein pahanuch gaya. Vahaan par ham sirf 20-25 students the. Vahaan na bijli thi na paani. Ham log laalaten ke sahaare raha karte the. Apne kapade khud dhone hote the aur khaana bhi khud pakaana hota tha. Ham nadi se paani laate the aur yahaan tak ki sabjiyaan bhi khud ugaate the. Mujhe lagta hai ki mainne apni jindagi ke sabse bade sabak gurukul mein bitaae 5 saalon ke dauraan hi seekhe. Gurukul ke baad filmon mein kaise ? Uske baad main Bengaluru gaya aur do saal vahaan rahane ke baad America chala gaya. Vahaan mainne aage ki padhaai ki. Uske baad mainne daayarekshan ka course kiya. Fir Delhi laut aaya aur kuchh short filmein banaai. Daraasal , main hamesha se director hi banana chaahata tha. Isliye mainne usaki training li , jabki mainne acting ki training kabhi naheen li. Isi beech main Mumbai aaya aur Abbas ji se meri mulaakaat hui aur main ' jaane too ya jaane na ' se acting ke field mein aa gaya. Aapko naheen lagta ki apne chaukaleti luks ki vajah se aap aasaani se Matru ya fir Don jaise kirdaaron mein fit naheen ho paate ? Isliye meri koshish rahati hai ki main poori tarah apne kairektar mein dhal jaaoon , taaki log mujhe dekhkar mere kairektar mein kho jaaen. Aur rahi baat Don ki , to aap agar Mumbai ki sadkon par jaaen , to vahaan par musalmaan naujavaan meri hi tarah dikhte hain. Unka bhi fair kalar , brown daadhi aur laait aankhein hain. Daraasal , humne filmon mein Don ki ek imej banaai hui hai ki ve Dirk glaasej hi pahaneinge , unke chehare par massa hoga aur is tarah ke dikheinge. Jabki asal mein aisa hai naheen. Isliye main to yahi kahanooga ki mainne to kabhi aisa naheen socha ki main apne chaukaleti luks ki vajah se kirdaaron mein fit naheen ho paata. Meri soch Yeh rahati hai ki main is kairektar ke saath insaaf kar paaoonga ya naheen. Uske baad main apne luk ke saath poora insaaf karne ki koshish karta hanoo. Jaise ki Matru ke liye mujhe apni brown kalar ki daadhi ko black kalar mein rangana pada. Aapki filmon ke beech kaafi gaip rahata hai. Kya vajah rahati hai iski ? Main chooji naheen hanoo. Lekin itna jaroor hai ki main ek vakt par do kaam naheen kar paata hanoo. Jaise ki jis vakt main shooting kar raha hota hanoo , to main kisi aur film ke baare mein soch bhi naheen sakta. Aur to aur main uske baare mein naireshan bhi naheen sunata. Khaate vakt main TV naheen dekh sakta , to kisi se baat karte vakt likh naheen sakta. Yahi vajah hai ki main ek time mein ek hi film hi karta hanoo. Kya isse aapko faayda milta hai , kyonki fains ko aapki filmon ka intajaar rahata hai ? Thoda bahut faayda to milta hai. Lekin back tu back kaamayaab filmein release hone se aapko fains ke najadeek aane ka jyaada mauka milta hai. Lekin iske liye aapko eksatra efart karne padte hain. Masalan double shift mein alag - alag filmon mein kaam karna hoga. Lekin main aisa naheen karta , kyonki mujhe lagta hai ki aisa karne se meri acting par asar padega. Meri aisi nechar bachapan se hi hai.


'Pulisgiri Ki Screening Mein Pahuncheen Maanyata

'Pulisgiri Ki Screening Mein Pahuncheen Maanyata

Movies »

haal hi mein maanyata datt apne donon bachchon ke saath najar aain. Mauka tha unke pati sanjaya datt ki aane waali film 'Pulisgiri'Ki screening ka. Unka luk bilkul sinpal tha. Green aur vaait kalar ki dres mein vah ekdam kool dikh rahi theen. Aamtaur par mekaap mein dikhne waali maanyata ne is din bina mekaap ke hi dikheen. Maanyata ke saath unke donon bachche bhi the. Maanyata ke bachchon ne doosare bachchon ke saath kuchh der masti bhi ki. Film dekhne ke dauraan maanyata ki aankhon mein aansoo bhi aa gaye. Gaurtalab hai ki sanjoo ke jail jaane ke baad se hi maanyata unki aane waali film 'Pulisgiri' ko lekar kaafi gambhir hain. Vah Yeh bhi kah chuki hain ki is film ke promotion ya is tarah ki aiktiviteej se juda koi bhi kaam karna pada, to vah kisi bhi vakt taiyaar hain.


Maired Hain Salman Ki Dost

Maired Hain Salman Ki Dost

Movies »

Salman Khan ka naam in dinon romaaniyn TV enkar luliya vantur ke saath joda ja raha hai. Donon ko ek saath kai maukon par dekha bhi gaya hai. Kaha ja raha hai ki luliya Salman ki nai garlafreind hai. Majedaar baat Yeh hai ki Salman Khan se pehle luliya vantur ka ishk romaaniya ke hi ek aartist meriys moga ke saath tha. Meriys moga myoojik ke kshetr se jude hain aur gremi award ke liye ek baar nauminet bhi ho chuke hain. Donon Europe ke kai akhbaaron ki surkhiyon mein kai baar rah chuke hain. Ek baar to meriys ke Facebook pej par unka status maired sho kar raha tha. Unhonne Facebook par dikleyar kiya tha ki vah aur luliya aapas mein shaadeeshuda hain. Ek baar donon ki lip lauk waali photo bhi chhapi thi. Baad mein donon ka break ap bhi kaafi charcha mein raha tha.


Uttaraakhand Ke Liye Sanjoo Ki 'Pulisgiri

Uttaraakhand Ke Liye Sanjoo Ki 'Pulisgiri

Movies »

Jail mein saja kaat rahe sanjaya datt uttaraakhand ki tabaahi ko lekar pareshaan hain aur unki madad karna chaahate hain. Sanjaya ne apni film pulisgiri ka ek khaas sho Mumbai mein rakhavaaya aur isse hui aay uttaraakhand peediton ko dene ka faisala kiya hai. Sanjaya ne kaha ki unki film pulisgiri ke Premier se ekattha kiye gaye paise ko pradhaanamantri naishanal raahat fund mein daan kiya jaae. Pradyoosar Rahul aur teepi Agrawal ne pulisgiri ki special screening areinj ki thi. Special screening mein datt ki vaaif maanyata aur industry ke kai bade log maujood the. Mahesh bhatt, banti vaaliya, apoorva lakhiya samet kai hastiyaan maujood theen. Screening dekhne ke baad mahesh bhatt ne kaha ki sanjaya ne ek baar fir saabit kar diya ki vah behatareen aur sachche aiktar hain. Unhonne apni parsanal pareshaaniyon ko prafeshanal life par haavi naheen hone diya. Pulisgiri shukravaar ko release ho gayi hai. Dekhne Yeh hai ki special guest ke alaava kya aam aadmi ko bhi Yeh film pasand aati hai.


Mallika Ko Doolha Milne Mein Deri

Mallika Ko Doolha Milne Mein Deri

Movies »

Apne traival schedule ki vajah se mallika saharaavat ne chhote parde ke schedule ki det aage badha di hai. Ek intaranaishanal sho ka hindustaani varjan agale maheene TV par prasaarit hone vaala tha, lekin mallika ke paas is sho ke liye time hi naheen hai. Is sho mein unhein apne liye jeevanasaathi ki talaash karni hai. Mallika afana jyaadaatar vakt America mein hi bita rahi hai. Sootron ke anusaar ab sho ki shooting ko agale maheene ki bajaae September tak ke liye taal diya gaya hai. Sho ke liye odishn desh mein alag-alag jagah par ho hi rahe hain. Shooting ke liye mallika ka Mumbai mein rahana jaroori hai. Ek baar to channel ke saamane Yeh bhi saaf ho gaya tha ki ve mallika ke bagair hi shooting shuroo kar sakte hain. April mein sho ke lauching par bataaya gaya tha ki mallika ke liye usaka prince chaarming khoja ja raha hai. Unka kehna tha ki vah is sho ka aham hissa isliye ban rahi hai kyonki vah abhi tak singal hai. Usaka kehna hai ki paisa jaroori hai lekin Yeh saaf kar doon ki sirf paise ke liye hi mein is sho ko naheen kar rahi hoon. Mera maksad logon ko bataana aur jaagruk karna hai ki mahilaaon ko bhi adhikaar hai ki vah apna jeevanasaathi chun sakein.


Imran Ke Opojit Ho Sakti Hain Shraddha

Imran Ke Opojit Ho Sakti Hain Shraddha

Movies »

Bhatt camp ki agali film ke liye heroine ka naam lagbhag tay ho gaya hai. Daraasal bhatt camp ki hi film aashiki-2 se bollywood mein debyoo karne waali shraddha Kapoor ko 'Dil hai ki maanata naheen' ke reemek ke liye chuna ja sakta hai. Khabaron ka baajaar garm hai ki unhein Imran Hashmi ke opojit kaast kiya ja sakta hai. Daraasal bhatt camp shraddha ke kaam se khaasa khush hai. Isliye usane shraddha ko sign karne ka man banaaya hai. Pehle khabar I thi ki 'Dil hai ki maanata naheen' ko pooja bhatt pradyoos kareingi. Daraasal pooja chaahati theen ki ismein vah bataur heroine Imran ke opojit apni step sistar aaliya bhatt ko sign karein lekin Imran ne aaliya ke saath kaam karne se mana kar diya tha. Imran aur aaliya aapas mein ek-doosare ke kajan hain. Jiske baad se ab shraddha Kapoor ke naam par atkalein lagaai ja rahi hain. Dekhna hai ki kaun baaji maarta hai.


Aaditya Ke Liye Likhi Ja Rahi Hai Special Script

Aaditya Ke Liye Likhi Ja Rahi Hai Special Script

Movies »

Film nirmaata bijya Nambiar ab aaditya Roy Kapoor ko lekar ek film banaane ki yojana bane rahe hain. Bijya ka kehna hai ki unki script lagbhag poori hone ko hai. Bijya ne bataaya ki is film ko aaditya ko kendra mein rakhakar hi likha ja raha hai. Isse pehle 'David' aur 'Shaitaan' film bana chuke bijya ne abhi iska moovi ka naam final naheen kiya hai, lekin unase jude ek sootr ke anusaar Yeh ek kaumidi kam aikshan film hogi. Saaf hai ki box office ka poora masaala hoga. Aaditya isse pehle aashiki-2 jaisi super hit film de chuke hain. Vah 'Ye javaani hai deevaani mein' bhi dikhaai diye the.


Salman Ki Nai Dost Pehle Thi Romaaniyn Aartist Ki Garlafreind

Salman Ki Nai Dost Pehle Thi Romaaniyn Aartist Ki Garlafreind

Movies »

Salman Khan ka naam in dinon romaaniyn TV enkar luliya vantur ke saath joda ja raha hai. Donon ko ek saath kai maukon par dekha bhi gaya hai. Kaha ja raha hai ki luliya Salman ki nai garlafreind hai. Majedaar baat Yeh hai ki Salman Khan se pehle luliya vantur ka ishk romaaniya ke hi ek aartist meriys moga ke saath tha. Meriys moga myoojik ke kshetr se jude hain aur gremi award ke liye ek baar nauminet bhi ho chuke hain. Donon Europe ke kai akhbaaron ki surkhiyon mein kai baar rah chuke hain. Ek baar to meriys ke Facebook pej par unka status maired sho kar raha tha. Unhonne Facebook par dikleyar kiya tha ki vah aur luliya aapas mein shaadeeshuda hain. Ek baar donon ki lip lauk waali photo bhi chhapi thi. Baad mein donon ka break ap bhi kaafi charcha mein raha tha.


Sooraj Ko Mila Salman Ka Saath

Sooraj Ko Mila Salman Ka Saath

Movies »

Aaditya pancholi ke bete sooraj pancholi apne filmi career ki shuruaat Salman Khan ki film se karne vaale the. Gaurtalab hai ki Salman sooraj ko lekar subhaash ghai ki 1983 mein I film 'Hero' ka reemek banaane ki plaining kar rahe the, lekin jiya Khan maamale mein jail jaane ke baad sooraj ke is film mein kaam karne ko savaal uthaae jaane lage the. Lekin ab khabar hai ki Salman Khan ki or se sooraj ko Hyderabad pahunchakar unase milne ke liye kaha gaya hai. Bata dein ki is film aaditya pancholi bhi aikting kareinge. Iske liye donon baap-beta Hyderabad ja rahe hain. Is film ki shooting is saal ke aakhir mein shuroo hogi. Film ki heroine suneel Shetty ki beti athiya Shetty hongi. Vaheen sooraj ke pairants ne unke maamale mein koi bhi laaparavaahi naheen baratne ka faisala kiya hai. Iske liye sooraj ke ghar par CCTV camere lagaae jaaenge aur unase milne aane-jaane vaalon par najar rakhi jaaegi.


Sonaakshi-Imran Ne Kavvaali Par Kiya Kamaal

Sonaakshi-Imran Ne Kavvaali Par Kiya Kamaal

Movies »

Sonaakshi sinha aur Imran Khan ne haal hi mein dhamaal macha diya. In donon ne kavvaali par itna jabardast parafaurm kiya ki sab hairaan rah gaye. Chamakate-dhamakate kapadon mein donon shaaining star lag rahe the. Mauka tha inki aane waali film 'Vans upon a time in Mumbai returns'Ke gaane 'Taiyyab Ali' ke launch ka. Yeh ek kavvaali track hai. Is dauraan Imran ke kapadon ne to kamaal hi kar diya tha. Oreinj kalar ki shart aur green fainsi jacket mein unka luk bilkul tipikl tha. Haalaanki, sonaakshi soot mein fir bhi sinpal dikh rahi theen ya yoon kahein ki Imran ke aage thodi feeki lag rahi theen. Vaise, kuchh bhi kaho lekin sonaakshi aur Imran ka jaadoo barkaraar raha. Gaurtalab hai ki Yeh kavvaali film 'Amar Akbar enthani'Mein thi, jismein rishi Kapoor aur neetoo Singh ne apna jalwa khoob dikhaaya tha. Bata dein ki is film mein Akshay Kumar bhi hain aur ise ekta Kapoor prodyoos kar rahi hain.


'Pulisgiri Ki Screening Mein Pahunchi Maanyata

'Pulisgiri Ki Screening Mein Pahunchi Maanyata

Movies »

haal hi mein maanyata datt apne donon bachchon ke saath najar aain. Mauka tha unke pati sanjaya datt ki aane waali film 'Pulisgiri'Ki screening ka. Unka luk bilkul sinpal tha. Green aur vaait kalar ki dres mein vah ekdam kool dikh rahi theen. Aamtaur par mekaap mein dikhne waali maanyata ne is din bina mekaap ke hi dikheen. Maanyata ke saath unke donon bachche bhi the. Maanyata ke bachchon ne doosare bachchon ke saath kuchh der masti bhi ki. Film dekhne ke dauraan maanyata ki aankhon mein aansoo bhi aa gaye. Gaurtalab hai ki sanjoo ke jail jaane ke baad se hi maanyata unki aane waali film 'Pulisgiri' ko lekar kaafi gambhir hain. Vah Yeh bhi kah chuki hain ki is film ke promotion ya is tarah ki aiktiviteej se juda koi bhi kaam karna pada, to vah kisi bhi vakt taiyaar hain.


Deepika Ne Chalaaya Scooter, Shahrukh Ne Ki Savaari

Deepika Ne Chalaaya Scooter, Shahrukh Ne Ki Savaari

Movies »

agar deepika Padukon scooter chalaaengi aur peechhe Shahrukh Khan baithe honge, to sochiyekaisa lagega? Hansi ka ful doj hoga na? Yeh najaara tha dikha TV sho 'Kaumidi nights vid Kapil' ke set par. Deepika, Shahrukh aur rohit Shetty apni aane waali film 'Chainnai express' ke promotion ke liye vahaan pahunche the. Odinyas ki hansi ka thikaana naheen rahana jab kapit aur Shahrukh ne apne mast mein andaaj mein baat karni shuroo kar di. Aur Shahrukh ne to had kar di jab unhonne sho mein Kapil ki mausi bane Ali ko jabardast kis kar diya. Kul milaakar bachchon se lekar badon tak ne khoob injauya kiya.


Faimili Kaumidi= Double Meening, Nauti Ya Valgar Joks

Faimili Kaumidi= Double Meening, Nauti Ya Valgar Joks

Movies »

Saroj Dhulia. . Shilpi apni faimili ke saath ek paupyular kaumidi sho dekh rahi thi. Tabhi ek jok sunaaya gaya: Ladki: Ab bas bhi karo. Kisi ne dekh liya to? Ladka: Kuchh naheen hota. Bas seedha kholkar rakho. Ladki: Naheen, ab naheen. Ladka: Pleej! Paanch minute utaarane do na, naheen to main egjaam mein fail ho jaaoonga. Is par shilpi khisiya gain. Fir jab aise joks ka aana ruka naheen, to use vahaan se uthakar jaana hi behtar laga. 'Moovars end shekars' aur 'Pol khol' jaise TV shoj ko host kar chuke shekhar suman ka kehna hai ki kuchh aartists valgairiti ko hi kaumidi maan baithe hain. Raatonraat star banane ki apni khvaahish mein unako Yeh shaurtakat najar aane laga hai. Kya doosaron ko hansaane ke liye aisi cheejon ka sahaara lena sahi hai? Is baare mein humne baat ki kuchh jaanemaane kaumidiyans se: Kaumidi shoj par aise double meening daayalaugs ke baare mein shekhar suman kehte hain, 'Kisi ko hansaane ke liye aise double meening dialogue ko pesh karna, jinhein faimili ke saath dekhte hue sharm aa jaae, meri samajh se achhi kaumidi ki hatya karne ki tarah hai. Kisi ki parsanal life par behooda kaumeint karna, shoj mein suhaagaraat se lekar bedaroom tak ke kisson ko pesh karke hansaana meri samajh se pare hai. Kaumidi ke naam par in foohad nuskhon ko aajmaana saraasar galat hai. Nauti hon, lekin valgar naheen paanch saal pehle TV par ikka dukka kaumidi shoj hi aate the, lekin badalate samay ke saath kaumidi ke faurmait mein change aata gaya. 'Kaumidi sarkas' mein feemel kirdaar aur ab 'Kaumidi nights vid Kapil' mein paavaraful daadi ke rol mein khoob taareefein bator rahe asagar Ali kehte hain, 'Mera maanana hai ki kaumidi shoj nauti hon, lekin valgar naheen. Ve aapka stres leval kam karein, na ki badhaaen. ' bakaul Ali, 'Main khud apne bachchon ke saath baithakar in shoj ko dekhta hoon, isliye chaahata hoon ki kaumidi saaf suthari ho, to behtar hai. ' lekin aise majaak par unka kehna hai ki kabhi-kabhi aartist ke paas achhi script naheen hoti aur hyoomar nikaalna mushkil hota hai. Oopar se aartist par game jeetne ka preshar alag hota hai. Aise mein panch dene ke liye kuchh valgar shabdon ka istemaal sho mein jaan daalne ka kaam karta hai. Yeh performance naheen hai kya double meening dialogue kaumidi ko jyaada paavaraful banaate hain? Is baare mein staindaap kameediyn Kapil sharma kehte hain, 'Inka istemaal ve log karte hain, jo apne hunar se darshakon ko baandh naheen paate ya jinhein achha parafaurm karna naheen aata. Helthi kaumidi se odiyans jyaada judti hai aur isko karna aasaan bhi hota hai. Daraasal, hyoomar society se aata hai. Agar aap logon se intaraikshan karte hain, unako samajhte hain, to kaumidi karna aasaan ho jaata hai. Aisi kaumidi mein fir valgairiti bhi naheen hoti. Ek sho jeetne ke liye ho sakta hai ki Yeh tareeka aapke kaam aa jaae, lekin isse aap lamba naheen chala sakte. ' jab humne Kapil se poochha ki aapki kaumidi mein double meening joks ko pasand kiya jaata hai, to unhonne is baat se inkaar kiya ki ve apne joks mein double meening daayalaugs ki madad lete hain. Bakaul Kapil, jahaan tak meri baat hai to mainne apni kaumidi mein hamesha maryaada ka dhyaan rakha hai aur naitikta ko kabhi naheen laangha. Har sho ki apni odiyans kaumidi sho 'Taarak Mehta ka ulta chashma' mein leed kirdaar play kar rahi disha vakaani kehti hain, 'Kisi ko hansa paana kisi dava se kam naheen hota. Fir har sho ki apni odiyans hoti hai. Kisi par koi preshar naheen hota hai ki use kya dekhna hai aur sabhi ke paas apni chauis ke shoj hain. ' disha ka Yeh kehna sahi bhi hai. Ek samay tha, jab too meening daayalaugs ke liye paupular maraathi actor daada kondake aur kaadar Khan kaafi paupular the aur inki apni ek difreint fan fauloing thi. Kaumidi aur valgairiti mein antar Kapil kehte hain, 'Kaumidi aur valgairiti mein ek baareek rekha hoti hai, jiska dhyaan rakha jaana jaroori hai. ' vaheen shekhar suman kehte hain, 'Agar aap logon ko hansaana chaahate hain, to kauman main ki parsanal life se judi samasyaaon ke saath darshakon ko apne saath jodein. Netaaon ke kaaranaame, sarkaari ofison mein seat par baithe baabuon ki daadaagiri, mahangaai ki maar se aam aadmi ki badhti pareshaaniyon ko pesh karein. Lekin iske liye aapko AC ofison se baahar nikalkar script likhni hogi aur kaumidi ke dam par star ban rahe log aisa karne se kataraate hain. Daraasal, inhein raatonraat apni pehchaan banaane ka shaurtakat apne saath kisi sundari ki jodi banaane aur double meening dialogue se jo mil jaata hai. ' faimili kaumidi jyaada paupular teeaarapi par nazar daalein, to faimili drama besd kaumidi ko odiyans jyaada pasand kar rahe hain. Haal hi mein 'Kaumidi nights vid Kapil' ki teeaarapi doosare puraane shoj ki tulana mein 3.4 pauints jyaada rahi. 'Taarak Mehta ka ulta chashma' ki teeaarapi bhi doosare shoj ke mukaabale har hafte 2 se 3 point aage rahati hai. Aartist aur kameediyn amit Tandon kehte hain, 'Log aisi kaumidi pasand karte hain, jo unki life se judi ho. Jaise pati-patni ki nokajhonk, romance, faimili joks vagairah. Ruteen se judi baaton ko achhi objarveshan ke saath panch dete hue sunaaya jaae, to koi hanse bina naheen rah sakta. '


Moovi Rivyoo Lutera

Moovi Rivyoo Lutera

Movies »

Chandra mohan sharma nai Delhi. . Film 'Udaan' mein apni kaabiliyt ka loha manava chuke yang director vikramaaditya ne camere mein pachaas ke dashak ko jeevant karne ki koshish ki hai. Vikramaaditya ke saath is project mein chaar aur nirmaata shaamil hain. Film ki kahaani O henari ki 'The laast leef' se kaafi prabhaavit hai. Pachaas ke dashak ki kahaani mein seedhe-saade dikhne vaale yuvak ke kirdaar mein 'Band baaja baraat' fame ranaveer Singh ko lekar director ne sabhi ko chaunka diya. Kyonki agar ranaveer ki baat karein to unki pichhli filmon ke baad darshakon mein unki imej bindaas aur dilfeink yuvak ki bani hai, lekin is baar ranaveer ne apne kirdaar varun shreevaastav ke jariye apni imej ko poori tarah se badal daala hai. Kahaanee: Pachaas ke dashak mein desh mein badlaav ka daur chal raha hai. Navanirvaachit sarkaar jameendaari unmoolan kaanoon ko amaleejaama pahanaane ki firaak mein hai. Vaheen, Bengal ke ek gaanv ke jameendaar (baroon chanda) ko is baat ka jara bhi ehsaas naheen ki sarkaar aisa kuchh karne ki firaak mein hai. Jameendaar saahab apni badi haveli mein apni ikalauti laadali beti paakhi (sonaakshi sinha) ke saath apni basaai alag duniya mein ji rahe hain. Unki sabse badi kamjori paakhi hi hai. Ek din jameendaar saahab ke paas yuvak varun shreevaastav (ranaveer Singh) apne ek dost ke saath aata hai. Varun khud ko puraatatv vibhaag se aaya injiniyr bataata hai aur unki haveli ke aaspaas ki jameen par khudaai ki anumati maangata hai. Varun unhein bataata hai unki is jameen ke neeche hajaaron saal pehle ki ek sanskruti chhupi hui hai, jiski talaash mein dipaartameint ne unhein bheja hai. Jameendaar saahab khudaai ki anumati de dete hain. Varun ki kaabiliyt se prabhaavit hokar jameendaar saahab use sarkit house ki bajaae apni haveli mein hi rahane ki anumati dete hain. Yaheen paakhi aur varun ek-doosare ke najadeek aate hain. Paakhi ko varun ki khoobiyaan uske aur najadeek kheench rahi hain, lekin varun usase dooriyaan banaana chaahata hai. Aakhir ek din paakhi uske saamane apne ikatarafa pyaar ka ijahaar kar deti hai. Isi beech varun bhi paakhi ko chaahane lagta hai. Doosari or varun apne dost aur majadooron ke saath khudaai ke kaam mein laga hai. Ek din varun jameendaar saahab se paakhi se apne pyaar ka ijahaar karte hue shaadi ki ijaajat maangata hai. Isi beech varun aur usaka dost apne us maksad mein kaamayaab ho jaate hain, jise poora karte hi vah haveli se gaayab ho jaate hain. Lekin inke gaayab hote hi aisa sach saamane aata hai jo jameendaar saahab aur paakhi ke sapanon ko chakanaachoor kar deta hai. Aikting: Paakhi ke kirdaar mein sonaakshi sinha ne apne un aalochakon ko karaara javaab diya hai, jo use top hero ke saath thumake lagaane waali khoobsoorat gudiya kehte the. Ranaveer Singh intaraval tak niraash karte hain. Sonaakshi ke saamane unki aavaaj dab-si jaati hai. Haan, intaraval ke baad halki daadhi mein najar aae ranaveer ne khud ko saabit karne ki achhi koshish ki hai. Paakhi ke pita ke kirdaar mein varun chanda ne gajab abhinay kiya hai. Aarif jakaariya aur divya datta chhoti si bhoomikaaoein ke baavajood asar chhodne mein kaamayaab rahe. Nirdeshan: Vikramaaditya motavaani ne script ke saath poora nyaaya kiya hai. Script aur kirdaaron ki demand ke saamane unhonne box office ki demand ko haavi naheen hone diya. Intaraval se pehle ki film jyaada hi sust hai, lekin pachaas ke dashak mein shuroo hui is love story ko unhonne poori imaandaari ke saath pesh kiya hai. Vaheen jameendaari pratha ke khaatme ke daur ko bhi motavaani ne achhe dhang se pesh kiya hai. Leed kirdaaron ke alaava doosare kirdaaron ko bhi unhonne kaheen kamjor naheen padne diya. Haan, leek se hatkar kuchh naya pesh karne ki koshish mein film darshakon ki us class se door ho gayi hai, jo entertainment ke liye theatre ka rukh karte hain. Sangeet: Hava ke jhonke, kaagaj ke do pankh lekar. . . Sahit film ke doosare gaane is film ki prushthabhoomi par fit hain. Kyon dekhein: Agar aap bollywood ki chaaloo masaala aikshan thriller aur betuki kaumidi filmon ki bheed se alag hatkar bani ek prem kahaani dekhna chaahate hain, jo dheere-dheere aage khiskati hai, to lutera aapke liye hai.


Achhe Kaam Ko Log Pehchaan Hi Lete Hain Vikramaaditya Motavaani

Achhe Kaam Ko Log Pehchaan Hi Lete Hain Vikramaaditya Motavaani

Movies »

reena paareek vikramaatitya ne 'Udaan' banaai, to unke career ko pankh lag gaye. Baavajood iske, vah lambe gaip ke baad ab 'Lutera' lekar aae hain. Ek mulaakaat mein unhonne bataaya ki unako lagta hai ki bhaarateeya cinema aage badh raha hai aur masaala aur Art filmon ki kaitigri se baahar nikal aaya hai : 'Lutera' banaane ka aaidiya kaise aaya? Yeh kahaani mainne bahut pehle likhi thi lekin is par film banaane ki naheen sochi. Magar Yeh kahaani mere ek dost ne padhi thi aur usi ne mujhe yaad dilaaya ki us par film banaai ja sakti hai. Magar New York mein likhi Yeh chaar pannon ki kahaani par kya ho sakta tha, Yeh tay karna tha. Tab main bhavaani heeraapanda ke paas gaya aur unase diskas kiya. Is tarah film bani. Yeh film 'Udaan' se kaafi alag hai aur lambe gaip ke baad bhi? Gaip to bas aise hi ho gaya. Yeh film 2007 mein banaana chaahata tha, lekin pehle 'Udaan' bani. Uske baad kuchh aur banaane ki koshish thi, lekin vah naheen ban pai. Aur tab mainne 'Lutera' par focus kiya. Yeh kamarshal aur bade stars ki film hai, kyonki jindagi bhar to ek smaul faimili drama naheen bana sakta. Iski research kitni chaileinjing thi? Research mein hamein kaafi time laga. Us jamaane mein loeg kaise kapde aur joolari gahane pahanate the? Unke gharon mein bijli hoti thi ki naheen? Har chhoti se chhoti cheejon ki jaankaari li gayi hai. Vaise meri maan baangla hain, to har samar vaikeshan mein main vahaan jaata raha hoon. Isliye vahaan ke kalchar ke baare mein mujhe kaafi kuchh pata hai. Kya donon stars turant is film ke liye taiyaar ho gaye? Naheen. Ranaveer ne kaafi time liya. Vo shaukd tha, jab main Yeh script lekar unke paas gaya. Usane kaafi sochane ke baad haan kaha, magar sonaakshi ne turant film sign kar li thi. Kya aap bachapan se hi filmamekar banana chaahate the? Main to injeeneeyar banana chaahata tha. Lekin Yeh shauk 18-19 saal ki umr se laga. Daraasal, main das saal ka tha, tabhi mere pairants ka divors ho gaya tha. Tab meri maan ne line producer ka kaam jauin kiya. Ek teenaejar besd TV sho ke liye unhonne mujhe aur mere doston ko bhi vahaan kaam ke liye bulaaya. Iske baad hi mainne likhna shuroo kiya. Magar ' udaan ' ke baad aap turant laaim laait mein aa gaye ? Haan , magar iske peechhe bees saal ka straagal hai. Kaam achha karoge , to log pehchaan hi lete hain. Magar aapko bahut mehnat karni padti hai. Sanjaya leela bhansaali ne ' khaamoshi ' banaai aur vo flop rahi magar fir unhonne Salman ke saath ' ham dil de chuke sanam ' banaai. Imtiyaaj ne bhi ' socha na tha ' banaai aur iske flop rahane ke baavajood badi film ' jab vi met ' banaai. Aapki film par sanjaya leela bhansaali ki chhaap dikhaai deti hai ? Mainne chhah saal unke saath kaam kiya hai. Filmon ke baare mein sab kuchh unase hi seekha hai. Unase behtar kraaftamain koi naheen hai industry mein. Unke alaava , anuraag ki chhaap bhi meri filmon mein dikhaai deti hai. Kya aap doosaron ki kahaani ko daayarekt kareinge ? Haan , jaroor. Magar ismein vakt hai. Main sabse yahi kehta hoon ki pehli do ya teen filmein khud hi likho aur banaao. Kyonki uske liye aap lad sakte hain. Agar kahaani aur kirdaar doosare ke hote hain , to aap uske liye ladte naheen. Jab aap likhne se ubane lagein , to doosaron ki kahaani lo , kyonki usamein aapko ek nayaapan lagega. Sau saal ke baad bhi hamaara cinema world leval par naheen pahuncha hai ? Ab pahunchana shuroo ho gaya hai. Koi bhi badlaav overnight naheen hota. Agar main ' udaan ' 2005 mein banaata , to use das theatre bhi naheen milte. Lekin ab banaai to 200 theatre mile. Jab main Yeh film kaan film festival ke liye lekar gaya , to logon ne samjha ki aisi filmein bhi India mein banti hain. Vahaan ke logon ke liye Indian cinema ke do hi matlab hain , ya to bollywood masaala ya Art filmein. Middle of the line bhi filmein banti hain India mein , iski unhein ummeed naheen thi. Samay ke saath darshak maichyor ho gaye hain. To ab bhi agar kami rahi hai , to kahaan rahi hai ? Daraasal , world mein umr ke hisaab se cinema divaaid hain , jabki hamaare yahaan class ke hisaab se filmein banti hain. Yahaan chaahe singal screen - malteepleks kah lein , loar class , middle class kah lein ya vaait kaular ya blue kaular kah lein. In do tarah ke logon ke liye alag - alag filmein banti hain. Lekin ab filmamekars bhi samajhne lage hain ki cinema ke do world hote hain. Malteeplaiks aane ke baad logon ke paas chauis hai aur vo apni marji ki film dekh sakte hain. Yahi vajah hai ki achha cinema ban rah a hai.


Bachche Par Vivaad Se Dukhi Shahrukh

Bachche Par Vivaad Se Dukhi Shahrukh

Movies »

Haal hi mein teesari baar pita banane vaale bollywood aiktar Shahrukh Khan ne apne ghar aae nanhe mehmaan par chuppi tod di hai. Apni aane waali film 'Chennai express' ke promotion se jude ek program mein Shahrukh ne kaha ki khushi ke mauke par vivaad paida hone se vah dukhi hain. Gaurtalab hai ki khabar I thi ki saraugasi (kiraaye ki kokh) ke jariye 27 May ko bete ke pita banane vaale Shahrukh ne bachche ke janm se pehle ling pareekshan karaaya tha. Iski jaanch chal rahi hai aur 15 dinon mein beeemasi ke adhikaari is silsile mein 2 baar Shahrukh ke ghar ja chuke hain. Is poore vivaad ki vajah se Shahrukh dukhi hain. Unhonne kaha, 'Yeh bahut hi niji, naajuk aur gopaneeya maamala hai. Khushi aur udaasi ka milaajula roop hai. Main sambandhit adhikaariyon ke saath-saath sabhi logon se anurodh karna chaahata hoon ki ve jitna utsaah mere bachche ki jaanch-padtaal mein dikha rahe hain, utana utsaah kisi aur maamale mein dikhaaen. ' suniye: Shahrukh ne kya kaha teesare bachche ke baare mein kiye gaye savaalon ke javaab mein Shahrukh ne Budhvaar ko kaha, 'Mere bachche ke baare mein kisi aur din baat kareinge, aaj film ke baare mein baad karte hain. ' unhonne kaha ki is maamale ka dukhad pahaloo jab khatm ho jaaega, to main saari baatein aap sab se saajha karoonga. Isliye aap mere bachche ki jagah meri aane waali film par dhyaan dein. Isse pehle beeemasi ke adhikaariyon ne mangalvaar ko pushti ki thi ki Shahrukh aur Gauri ke teesare bachche ka janm saraugasi ke jariye 27 May ko andheri ke masaraani hauspitl mein hua hai. Saraugat maan ko lekar aadhikaarik roop se kuchh bhi naheen kaha gaya hai, par bataaya ja raha hai ki Gauri ki bhaabhi namita chhibbar hain. Beeemasi ke svaasthya adhikaari Dr. Arun baamane ke mutaabik, Shahrukh aur Gauri ka bachcha pregneinsi ke 34 vein hafte mein hua hai aur janm ke samay iska vajan 1.5 kilo tha. Jaankaari ke anusaar, bachche ko janm ke baad mein masaraani hauspitl se juhoo ke naanaavati hauspitl le jaaya gaya aur ant mein use breech candy hauspitl le jaaya gaya. Ab bachche ko breech candy hauspitl se chhutti mil chuki hai aur ab vah Khan faimili ke beech ghar par hi hai.